DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and rho4

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001018257.1 Gene:rho4 / 3361476 PomBaseID:SPAC16A10.04 Length:203 Species:Schizosaccharomyces pombe


Alignment Length:193 Identity:57/193 - (29%)
Similarity:86/193 - (44%) Gaps:35/193 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRKKS------LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVV--NDRVV 57
            ||..|||      ..|::::||...|||.|:..:.:..|..:|..|:..::.| ::..  |.:|:
pombe     1 MSAFKKSGSKSETSKKLVVVGDGGCGKTCLLIVFSSGTFPERYVPTVFENYIT-DITYGPNSKVI 64

  Fly    58 TMQIWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNL-DSWRDEFLIQASPRDPDHF--- 118
            .:.:|||||||.:..|....|..::..:|.:.:..|.|..|: :.|..|.         .||   
pombe    65 ELALWDTAGQEEYDRLRPLSYPNSNVILLCFSIDCPASLNNVTEKWYPEV---------QHFCPR 120

  Fly   119 -PFVVLGNKVDL--DNRQVSTRRAQ-------QWCQS---KNDIPYYETSAKEGINVEMAFQV 168
             |.|::|.|.||  |.......|.|       |..||   ..:.||.|.||||...|...||:
pombe   121 TPIVLVGLKADLRKDRNATEVLRTQGLTPVTYQQAQSVALSMNAPYVECSAKENTGVNEVFQL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 52/179 (29%)
RAB 9..174 CDD:197555 52/179 (29%)
rho4NP_001018257.1 Rho4_like 12..189 CDD:206704 52/182 (29%)
RHO 17..185 CDD:197554 51/177 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.