DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rab21

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster


Alignment Length:197 Identity:73/197 - (37%)
Similarity:114/197 - (57%) Gaps:12/197 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVND-RVVTMQIWDTAGQERFQSL 73
            |.::||:..||||||:.:|:..||:.|:.:|:.|.|.::::.:.| |...:.||||||||||.:|
  Fly    15 KAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQERFHAL 79

  Fly    74 GVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL-DNRQVSTR 137
            |..:|||:|..:||||:|..:||:.:.||..| |.|....:   ...:::|||.|| :.|.|:..
  Fly    80 GPIYYRGSDGALLVYDITDRDSFQKVKSWVRE-LRQMRGTE---IALIIVGNKTDLEEQRAVTHD 140

  Fly   138 RAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQNNRPGNP 202
            .|.|:.::.. ..|.||||||...|...|:::.:..||..::.:     ||...|..||....|.
  Fly   141 EALQYARTVG-AQYVETSAKENEGVAELFELLTQLMLEQLSQRQ-----PDASPLRLQNPDTDNL 199

  Fly   203 DN 204
            :|
  Fly   200 NN 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 66/170 (39%)
RAB 9..174 CDD:197555 64/165 (39%)
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 64/165 (39%)
Ras 15..177 CDD:278499 64/166 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454525
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.