DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rab5

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster


Alignment Length:205 Identity:80/205 - (39%)
Similarity:116/205 - (56%) Gaps:11/205 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAG 66
            |..|....|:::||:|:|||:||:.::|..:|....::||||.|.|:.:.:.|.||..:||||||
  Fly    23 SQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAG 87

  Fly    67 QERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN 131
            |||:.||...:||||...::|||:...:||:...:|..|...||||    :....:.|||.||.|
  Fly    88 QERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASP----NIVIALAGNKADLSN 148

  Fly   132 -RQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQ 195
             |.|....|:|:.: :|.:.:.|||||.|:||...|..|||   :|.......|........|::
  Fly   149 IRVVEFDEAKQYAE-ENGLLFMETSAKTGMNVNDIFLAIAK---KLPKNDGANNQGTSIRPTGTE 209

  Fly   196 NNRPGNPDNC 205
            .|||.|  ||
  Fly   210 TNRPTN--NC 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 70/170 (41%)
RAB 9..174 CDD:197555 69/165 (42%)
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 69/169 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454238
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.