DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rab35

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster


Alignment Length:169 Identity:72/169 - (42%)
Similarity:103/169 - (60%) Gaps:7/169 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
            |.|::|:|||.|||:||:.::.:..||..|..|||.||..:.|.:....|.:|||||||||||::
  Fly     8 LFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQERFRT 72

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNK-VDLDNRQVST 136
            :...:|||....::|||||...||.|:..|.:|  ||   .:.|....|::||| .|.|.:.|.|
  Fly    73 ITSTYYRGTHGVIVVYDVTNGESFANVRRWLEE--IQ---NNCDVVKKVLVGNKNDDPDRKVVIT 132

  Fly   137 RRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALE 175
            ..||::.: :.||..:|||||:.||||..|..|.:..|:
  Fly   133 EDAQRFAK-QMDIELFETSAKDNINVENMFLSITRQVLD 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 71/168 (42%)
RAB 9..174 CDD:197555 70/165 (42%)
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 72/169 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454526
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.