DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and AgaP_AGAP007369

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_564861.2 Gene:AgaP_AGAP007369 / 3290360 VectorBaseID:AGAP007369 Length:273 Species:Anopheles gambiae


Alignment Length:171 Identity:41/171 - (23%)
Similarity:87/171 - (50%) Gaps:6/171 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQER 69
            ||...:|.::|.:.|||:|:::|::.:::.::||.||......:..:.:...:|:.|.||:|..:
Mosquito    63 KKERHRVTMMGAARVGKSSIISQFLYEKYLSRYKQTIEEMHRGEYELPDGSSLTLDILDTSGSYQ 127

  Fly    70 FQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL--DNR 132
            |.::.......:...:|||.|....::..::..|::.:.....|    .|.|::|||.|:  ::|
Mosquito   128 FPAMRALSINTSGAFILVYAVDDEETWNEVERLREQIISVRGTR----VPIVIVGNKADVPEEDR 188

  Fly   133 QVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNA 173
            |:..:.|:.....:....|.|.|||....:...|:.:.:.|
Mosquito   189 QIPFKVARSRALLEWGCGYAECSAKNNEGILTVFKQLLRQA 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 39/167 (23%)
RAB 9..174 CDD:197555 39/167 (23%)
AgaP_AGAP007369XP_564861.2 RAS 67..231 CDD:214541 39/167 (23%)
P-loop_NTPase 68..272 CDD:304359 39/166 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.