DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and RabX2

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster


Alignment Length:194 Identity:68/194 - (35%)
Similarity:104/194 - (53%) Gaps:18/194 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
            |.||::||||.|||:.|:.::.:.||:.:|..|:|.|...:.|.:..||:.:|:|||:|.:||.|
  Fly     7 LFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDKRFNS 71

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVST 136
            |..:.||.|...:||||:|:..||:|:|.|..|.....    ||....:::|||.|..| ||||.
  Fly    72 LMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMC----PDKVTVLLVGNKSDDPNHRQVSM 132

  Fly   137 RRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAK------------NALELEAEAEVINDFPD 188
            .:...:.. :..:.:.|.|||.|:||...|..:|.            :.:..|.|.|...:.||
  Fly   133 EQGFNYAH-RGALGFEEVSAKSGMNVYDIFSSLAMDIYHRYVLHNPISPMPSEQEEEDAAESPD 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 63/182 (35%)
RAB 9..174 CDD:197555 62/177 (35%)
RabX2NP_572627.1 RAB 8..171 CDD:197555 62/167 (37%)
Rab 8..165 CDD:206640 61/161 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454335
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.