DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rab27

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster


Alignment Length:218 Identity:77/218 - (35%)
Similarity:111/218 - (50%) Gaps:27/218 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDR----VVTMQIWDTAGQERFQS 72
            ::||||.||||.|:.||.:.||..|:.:|:|.||..|.::.|.|    .:.:|||||||||||:|
  Fly    21 LVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTAGQERFRS 85

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVD-LDNRQVST 136
            |..||||.|...:|::|:|:..||....:|..:....|...|||   .|:.|||.| |..|.||.
  Fly    86 LTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPD---VVLCGNKCDLLQLRVVSR 147

  Fly   137 RRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDF--------------- 186
            .:....|: :..:||.||||..|.||:.|.:::....:|....|....:|               
  Fly   148 DQVAALCR-RYRLPYIETSACTGANVKEAVELLVGRVMERIENAACNREFSLLLTQSRCLPNIAY 211

  Fly   187 ---PDQITLGSQNNRPGNPDNCQ 206
               .|.:.|..:...|.:..||:
  Fly   212 GQPEDLVRLHDRREEPCSRRNCR 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 70/171 (41%)
RAB 9..174 CDD:197555 69/166 (42%)
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 70/169 (41%)
RAB 20..186 CDD:197555 69/168 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454530
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.