DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and CG13375

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001162628.1 Gene:CG13375 / 30976 FlyBaseID:FBgn0040370 Length:306 Species:Drosophila melanogaster


Alignment Length:216 Identity:61/216 - (28%)
Similarity:97/216 - (44%) Gaps:45/216 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVIILGDSSVGKTSLMNQYVNKRFSNQYKATI----GADFCTKEVVVNDRVVTMQIWDTAGQERF 70
            |::::|.:.|||||::.|::...||.:||.||    ..:|....|     .:|:.|.||||...|
  Fly    49 KIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGV-----SLTLDILDTAGSYEF 108

  Fly    71 QSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL--DNRQ 133
            .::.......||..:||||||...:|:.:.:.||:.   ...:.....|.||:|||:||  |.  
  Fly   109 PAMRALSISSADAFILVYDVTDATTFEEVRTIRDQI---HETKATTAVPIVVVGNKIDLLADG-- 168

  Fly   134 VSTRRAQQWCQSKNDIP------YYETSAKEGINVEMAFQVIAKNALELEAEAEVI--------- 183
             .|.|..::..:::.:.      :.|.||....|:...|:       ||.|:|::.         
  Fly   169 -ETEREVEYATTESVVTVDWENGFVEASASSNENITQVFK-------ELLAQAKITYNLSPALRR 225

  Fly   184 --NDFPDQITLGSQNNRPGNP 202
              ...|.||    .||.|..|
  Fly   226 RRQSLPQQI----GNNGPSTP 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 52/180 (29%)
RAB 9..174 CDD:197555 50/175 (29%)
CG13375NP_001162628.1 RAS 48..215 CDD:214541 54/183 (30%)
Ras_dva 49..239 CDD:206714 59/211 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.