DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rab5c

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001099310.2 Gene:Rab5c / 287709 RGDID:1307095 Length:216 Species:Rattus norvegicus


Alignment Length:171 Identity:69/171 - (40%)
Similarity:101/171 - (59%) Gaps:6/171 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAG 66
            :|.|....|:::||:|:|||:||:.::|..:|....::||||.|.|:.|.::|..|..:||||||
  Rat    15 AGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAG 79

  Fly    67 QERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL-D 130
            |||:.||...:||||...::|||:|..::|....:|..|...||||    :....:.|||.|| .
  Rat    80 QERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASP----NIVIALAGNKADLAS 140

  Fly   131 NRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAK 171
            .|.|..:.||.:... |.:.:.|||||..:||...|..|||
  Rat   141 KRAVEFQEAQAYADD-NSLLFMETSAKTAMNVNEIFMAIAK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 67/164 (41%)
RAB 9..174 CDD:197555 67/164 (41%)
Rab5cNP_001099310.2 Rab5_related 21..183 CDD:206653 67/165 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.