DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and ryh1

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_593249.1 Gene:ryh1 / 2543529 PomBaseID:SPAC4C5.02c Length:201 Species:Schizosaccharomyces pombe


Alignment Length:199 Identity:76/199 - (38%)
Similarity:115/199 - (57%) Gaps:11/199 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLG 74
            |::.||:.|||||||:.:::..:|.|.|:||||.||.:|.:.:.||.|.:|:|||||||||:||.
pombe    13 KLVFLGEQSVGKTSLITRFMYDQFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLI 77

  Fly    75 VAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL-DNRQVSTRR 138
            .::.|.:...::|||:|..|||.|.:.|.::...:..    |....|::|||.|| |.|||:...
pombe    78 PSYIRDSSVAIIVYDITNHNSFVNTEKWIEDVRAERG----DDVIIVLVGNKTDLADKRQVTQEE 138

  Fly   139 AQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQNNRPGNPD 203
            .::..:... |.:.|||||.|.||::.|:.||:....:|   .|.......|.:..|.|.  |..
pombe   139 GEKKAKELK-IMHMETSAKAGHNVKLLFRKIAQMLPGME---NVETQSTQMIDVSIQPNE--NES 197

  Fly   204 NCQC 207
            :|.|
pombe   198 SCNC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 69/169 (41%)
RAB 9..174 CDD:197555 68/164 (41%)
ryh1NP_593249.1 Rab6 12..172 CDD:206654 68/163 (42%)
RAB 12..170 CDD:197555 67/161 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.