DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and ypt71

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_593524.1 Gene:ypt71 / 2543411 PomBaseID:SPAPB1A10.10c Length:208 Species:Schizosaccharomyces pombe


Alignment Length:212 Identity:112/212 - (52%)
Similarity:155/212 - (73%) Gaps:9/212 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTA 65
            ||.:|:..|||:|||||.||||.||||:||::||.:|||||||||.||:|||:|::||:|:||||
pombe     1 MSAQKRVFLKVVILGDSGVGKTCLMNQFVNQKFSREYKATIGADFLTKDVVVDDKLVTLQLWDTA 65

  Fly    66 GQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLD 130
            |||||||||:||||||||||:||:|....||.::::||.|||.|.| :|...|||:::||::|.|
pombe    66 GQERFQSLGMAFYRGADCCVIVYNVNNSKSFDSVENWRQEFLYQTS-QDECAFPFIIVGNQIDKD 129

  Fly   131 --NRQVSTRRAQQWCQSK--NDIPYYETSAKEGINVEMAFQVIAKNALELEAEA-EVINDFPDQI 190
              .|.||..||..:|:||  :::.::|.||||..||...|:.:::.|||.|:.. :.:|||.:.:
pombe   130 ASKRAVSLHRALDYCKSKHGSNMIHFEASAKENTNVTDLFETVSRLALENESSRDDFVNDFSEPL 194

  Fly   191 TLGSQNNRPGNPDNCQC 207
            .|....|   |..:|.|
pombe   195 LLSKPLN---NTSSCNC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 101/173 (58%)
RAB 9..174 CDD:197555 97/168 (58%)
ypt71NP_593524.1 Rab7 9..182 CDD:206655 101/173 (58%)
RAB 9..179 CDD:197555 99/170 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47981
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.