DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and ypt2

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_594580.1 Gene:ypt2 / 2543280 PomBaseID:SPAC9E9.07c Length:200 Species:Schizosaccharomyces pombe


Alignment Length:195 Identity:70/195 - (35%)
Similarity:115/195 - (58%) Gaps:13/195 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
            |:|::::|||.|||:.|:.::....|:..:..|||.||..:.:.::.:.:.:|||||||||||::
pombe     9 LIKLLLIGDSGVGKSCLLLRFSEDSFTPSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRT 73

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL-DNRQVST 136
            :..|:||||...:|:||||...||.|:.:|.......||    ::...:::|||.|. |.||||.
pombe    74 ITTAYYRGAMGILLLYDVTDKKSFDNVRTWFSNVEQHAS----ENVYKILIGNKCDCEDQRQVSF 134

  Fly   137 RRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQ---ITLGSQNNR 198
            .:.|....... :.:.|.|||..:||:.||..:|:...:.:.:||  |:|.:|   :.||  |:|
pombe   135 EQGQALADELG-VKFLEASAKTNVNVDEAFFTLAREIKKQKIDAE--NEFSNQANNVDLG--NDR 194

  Fly   199  198
            pombe   195  194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 60/170 (35%)
RAB 9..174 CDD:197555 60/165 (36%)
ypt2NP_594580.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 61/168 (36%)
Ras 11..172 CDD:278499 60/165 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.