DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and rho2

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_594569.1 Gene:rho2 / 2542773 PomBaseID:SPAC16.01 Length:200 Species:Schizosaccharomyces pombe


Alignment Length:179 Identity:48/179 - (26%)
Similarity:91/179 - (50%) Gaps:20/179 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLG 74
            |::::||.:.|||||::.:....|..:|..|:..:: ..:..|:.:.|.:.:|||||||.::.|.
pombe    10 KLVVVGDGACGKTSLLSVFTLGYFPTEYVPTVFENY-VSDCRVDGKSVQLALWDTAGQEEYERLR 73

  Fly    75 VAFYRGADCCVLVYDVTAPNSFKNLDS-WRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVS--- 135
            ...|..|...::.:.:.:|:|.:|:.: |.:| :....|    :.||:::|.|.||.:..|:   
pombe    74 PMSYAKAHIILVGFAIDSPDSLENVSTKWIEE-INTLCP----NVPFILVGMKADLRSDPVAIEE 133

  Fly   136 -TRRAQQWCQSK---------NDIPYYETSAKEGINVEMAFQVIAKNAL 174
             .||.|.:.:|:         ....|.|.|:..|..|:..|:...:.||
pombe   134 MRRRNQNFVKSQQAELVAQRIGARKYMECSSLTGDGVDDVFEAATRAAL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 48/179 (27%)
RAB 9..174 CDD:197555 46/177 (26%)
rho2NP_594569.1 Rho2 8..199 CDD:206702 48/179 (27%)
RHO 11..183 CDD:197554 47/178 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.