DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and ypt4

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_594796.1 Gene:ypt4 / 2542113 PomBaseID:SPAC1B3.11c Length:234 Species:Schizosaccharomyces pombe


Alignment Length:207 Identity:75/207 - (36%)
Similarity:113/207 - (54%) Gaps:17/207 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVV----NDRVVTMQIWDTAGQE 68
            |:|:::.|.|..||:.|:.::|..::.:|...|:|.||.::.:.|    ..:.:.:|||||||||
pombe     9 LVKIVLAGPSGTGKSCLLQRFVKNQWDDQVSHTVGIDFASRIISVGMGNQQKRIKLQIWDTAGQE 73

  Fly    69 RFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-R 132
            :|:|:...:||||...|||||||..:||:.|.||..:....|    |.....|:.|:|.||.| |
pombe    74 KFRSVARNYYRGAAGAVLVYDVTNKDSFEELSSWLSDIRAMA----PSTICVVLAGSKSDLQNQR 134

  Fly   133 QVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQN- 196
            ||||..|.::|..|:....:|||:..|.|||..|..:....:......|:  |..|| :||.|. 
pombe   135 QVSTEEAAEFCSEKHISSAHETSSYTGSNVEECFLSVVSTIITRIELGEI--DPQDQ-SLGIQYG 196

  Fly   197 ----NRPGNPDN 204
                .||.:|.:
pombe   197 DLSFRRPVHPSS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 64/174 (37%)
RAB 9..174 CDD:197555 64/169 (38%)
ypt4NP_594796.1 RAB 10..178 CDD:197555 64/171 (37%)
Rab 10..173 CDD:206640 64/166 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.