DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and ypt7

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_596307.1 Gene:ypt7 / 2540763 PomBaseID:SPBC405.04c Length:205 Species:Schizosaccharomyces pombe


Alignment Length:209 Identity:132/209 - (63%)
Similarity:165/209 - (78%) Gaps:6/209 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTA 65
            |:|:||.||||||||:|.|||||:||||||::||..|||||||||.||||:|:|:|||:|:||||
pombe     1 MAGKKKHLLKVIILGESGVGKTSIMNQYVNRKFSKDYKATIGADFLTKEVLVDDKVVTLQLWDTA 65

  Fly    66 GQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLD 130
            |||||||||||||||||||||||||....||:.||||||||||||||.:|:.|||::||||||::
pombe    66 GQERFQSLGVAFYRGADCCVLVYDVNNSKSFETLDSWRDEFLIQASPSNPETFPFILLGNKVDVE 130

  Fly   131 --NRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLG 193
              .|.||..:|..:||::.:|||:||||||.|||:.||:.:||.|||.....::..||.|.|.|.
pombe   131 EQKRMVSKSKALAFCQARGEIPYFETSAKEAINVQEAFETVAKLALENMDSDDIAADFTDPIHLD 195

  Fly   194 SQNNRPGNPDNCQC 207
            .::.:    .:|.|
pombe   196 MESQK----TSCYC 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 120/171 (70%)
RAB 9..174 CDD:197555 117/166 (70%)
ypt7NP_596307.1 Rab7 9..181 CDD:206655 120/171 (70%)
RAB 9..178 CDD:197555 119/168 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 245 1.000 Domainoid score I426
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 268 1.000 Inparanoid score I718
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001661
OrthoInspector 1 1.000 - - oto101161
orthoMCL 1 0.900 - - OOG6_101358
Panther 1 1.100 - - LDO PTHR47981
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2001
SonicParanoid 1 1.000 - - X1058
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.