DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and spi1

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_596827.1 Gene:spi1 / 2540149 PomBaseID:SPBC1289.03c Length:216 Species:Schizosaccharomyces pombe


Alignment Length:211 Identity:57/211 - (27%)
Similarity:105/211 - (49%) Gaps:25/211 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLG 74
            |::::||...|||:.:.:::...|..:|.||:|.:........|...:...:|||||||:...|.
pombe    11 KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATLGVEVHPLHFHTNFGEICFNVWDTAGQEKLGGLR 75

  Fly    75 VAFYRGADCCVLVYDVTAPNSFKNLDS-WRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTRR 138
            ..:|....|.::::|||:..::||:.. |||  |::..    ::.|.|:.|||||:..|:|.. :
pombe    76 DGYYIQGQCGIIMFDVTSRITYKNVPHWWRD--LVRVC----ENIPIVLCGNKVDVKERKVKA-K 133

  Fly   139 AQQWCQSKNDIPYYETSAKEGINVEMAF-------------QVIAKNAL---ELEAEAEVINDFP 187
            |..:.:.|| :.||:.|||...|.|..|             :.:|..||   |::.:.:::..:.
pombe   134 AITFHRKKN-LQYYDISAKSNYNFEKPFLWLARKLVGNPNLEFVASPALAPPEVQVDQQLLAQYQ 197

  Fly   188 DQITLGSQNNRPGNPD 203
            .::...:....|...|
pombe   198 QEMNEAAAMPLPDEDD 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 55/185 (30%)
RAB 9..174 CDD:197555 52/177 (29%)
spi1NP_596827.1 PTZ00132 1..213 CDD:240284 56/209 (27%)
Ran 10..175 CDD:206643 51/171 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.