DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and ypt1

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_596205.1 Gene:ypt1 / 2539784 PomBaseID:SPBC1703.10 Length:203 Species:Schizosaccharomyces pombe


Alignment Length:207 Identity:70/207 - (33%)
Similarity:114/207 - (55%) Gaps:21/207 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
            |.|::::|||.|||:.|:.::.:..::..|.:|||.||..:...:..:.|.:|||||||||||::
pombe     8 LFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTFELEGKTVKLQIWDTAGQERFRT 72

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWR---DEFLIQASPRDPDHFPFVVLGNKVDL-DNRQ 133
            :..::||||...::|||||..:||.|:..|.   |.:.::...|       :::|||.|: |.:.
pombe    73 ITSSYYRGAHGIIIVYDVTDQDSFNNVKQWLQEIDRYAVEGVNR-------LLVGNKSDMVDKKV 130

  Fly   134 VSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDF-----PDQITLG 193
            |....|:::..|.| ||:.|||||:..|||.||..:::...|....    |.|     ...:.:|
pombe   131 VEYSVAKEFADSLN-IPFLETSAKDSTNVEQAFLTMSRQIKERMGN----NTFASSNAKSSVKVG 190

  Fly   194 SQNNRPGNPDNC 205
            ...|...:..||
pombe   191 QGTNVSQSSSNC 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 63/173 (36%)
RAB 9..174 CDD:197555 62/168 (37%)
ypt1NP_596205.1 Rab1_Ypt1 7..172 CDD:206661 63/171 (37%)
RAB 9..172 CDD:197555 62/170 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.