DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rab7b

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_006529491.1 Gene:Rab7b / 226421 MGIID:2442295 Length:257 Species:Mus musculus


Alignment Length:207 Identity:96/207 - (46%)
Similarity:134/207 - (64%) Gaps:8/207 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTA 65
            |:.|||..||:||:|...||||||::|||:|.|..:|:.|:||...:|.::::|..:.:|||||.
Mouse    59 MNPRKKVDLKLIIVGALGVGKTSLLHQYVHKTFFEEYQTTLGASILSKIIILDDTTLKLQIWDTG 123

  Fly    66 GQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLD 130
            |||||:|:...||:|:|.|:|.:|||.|.||:.||.|||:.|.:..|.: ..:|.||||||:||:
Mouse   124 GQERFRSMVSTFYKGSDGCILAFDVTDPESFEALDIWRDDVLAKIIPME-QSYPMVVLGNKIDLE 187

  Fly   131 NRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQ 195
            :|:||......||:.| |:||:|.|||..|||..||:|:|..|| |..:....|...|.|.|.  
Mouse   188 DRKVSQEVVHGWCKEK-DMPYFEVSAKNDINVVQAFEVLASRAL-LRYQGTAENHLIDSIKLS-- 248

  Fly   196 NNRPGNPDNCQC 207
               ||.|.:..|
Mouse   249 ---PGQPKSRCC 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 84/169 (50%)
RAB 9..174 CDD:197555 81/164 (49%)
Rab7bXP_006529491.1 Rab 67..227 CDD:206640 80/161 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47981
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.