DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Ran

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_033417.1 Gene:Ran / 19384 MGIID:1333112 Length:216 Species:Mus musculus


Alignment Length:193 Identity:56/193 - (29%)
Similarity:98/193 - (50%) Gaps:17/193 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQ 67
            |..:...|::::||...|||:.:.:::...|..:|.||:|.:........|...:...:||||||
Mouse     5 GEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQ 69

  Fly    68 ERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDNR 132
            |:|..|...:|..|.|.::::|||:..::||:.:|..:.:     |..::.|.|:.|||||:.:|
Mouse    70 EKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLV-----RVCENIPIVLCGNKVDIKDR 129

  Fly   133 QVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKN----------ALELEAEAEVIND 185
            :|..:...  ...|.::.||:.|||...|.|..|..:|:.          |:...|..||:.|
Mouse   130 KVKAKSIV--FHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMD 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 51/179 (28%)
RAB 9..174 CDD:197555 50/174 (29%)
RanNP_033417.1 RAN 16..215 CDD:128473 54/182 (30%)
Interaction with RANBP1. /evidence=ECO:0000250|UniProtKB:P62826 211..216
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.