Sequence 1: | NP_001247276.1 | Gene: | Rab7 / 42841 | FlyBaseID: | FBgn0015795 | Length: | 207 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001311460.1 | Gene: | Rab3d / 19340 | MGIID: | 97844 | Length: | 219 | Species: | Mus musculus |
Alignment Length: | 210 | Identity: | 64/210 - (30%) |
---|---|---|---|
Similarity: | 115/210 - (54%) | Gaps: | 22/210 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
Fly 73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTR 137
Fly 138 RAQQWCQSKNDI--PYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQNNR-- 198
Fly 199 ------PGNPDNCQC 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab7 | NP_001247276.1 | Rab7 | 9..179 | CDD:206655 | 58/171 (34%) |
RAB | 9..174 | CDD:197555 | 58/166 (35%) | ||
Rab3d | NP_001311460.1 | Rab3 | 22..186 | CDD:206657 | 58/175 (33%) |
Effector region. /evidence=ECO:0000250 | 51..59 | 2/7 (29%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 190..219 | 4/28 (14%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |