Sequence 1: | NP_001247276.1 | Gene: | Rab7 / 42841 | FlyBaseID: | FBgn0015795 | Length: | 207 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_030105459.1 | Gene: | Rab11b / 19326 | MGIID: | 99425 | Length: | 278 | Species: | Mus musculus |
Alignment Length: | 221 | Identity: | 68/221 - (30%) |
---|---|---|---|
Similarity: | 124/221 - (56%) | Gaps: | 29/221 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 RKKSLLK-VIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQ 67
Fly 68 ERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN- 131
Fly 132 RQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQN 196
Fly 197 NRPGN---------------PDNCQC 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab7 | NP_001247276.1 | Rab7 | 9..179 | CDD:206655 | 60/171 (35%) |
RAB | 9..174 | CDD:197555 | 60/166 (36%) | ||
Rab11b | XP_030105459.1 | Rab11_like | 74..233 | CDD:206660 | 60/163 (37%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |