DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and F08G12.1

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_509888.1 Gene:F08G12.1 / 181320 WormBaseID:WBGene00008585 Length:635 Species:Caenorhabditis elegans


Alignment Length:169 Identity:42/169 - (24%)
Similarity:67/169 - (39%) Gaps:61/169 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVV---------NDRVVTMQIW-- 62
            ||::|.||.:||||.|..:.....|..:|.|       |:|:.|         .|.||.:.:|  
 Worm    44 LKIVIRGDRNVGKTCLWKRLQGLSFQEEYVA-------TEEIQVANINWNYRATDDVVKVDVWDI 101

  Fly    63 ------------------------------DTAGQERFQSLGVAFYRGADCCVLVYDVTAPNSFK 97
                                          |||...||    |..|:|.:..:.|:|:|      
 Worm   102 VDQSTKKRVKDDKLKLANNGMDKNDGLDYEDTACDARF----VDVYKGTNGVIFVFDIT------ 156

  Fly    98 NLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL-DNRQVS 135
              .:|..|::.:...:.|:..|.:||.|:.|: .:|||:
 Worm   157 --KTWTWEYVQKEIVKVPNKIPVLVLANRRDMGHHRQVT 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 42/169 (25%)
RAB 9..174 CDD:197555 42/169 (25%)
F08G12.1NP_509888.1 P-loop_NTPase 44..>193 CDD:304359 41/167 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.