Sequence 1: | NP_001247276.1 | Gene: | Rab7 / 42841 | FlyBaseID: | FBgn0015795 | Length: | 207 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001041294.1 | Gene: | rab-37 / 180696 | WormBaseID: | WBGene00004285 | Length: | 223 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 72/199 - (36%) |
---|---|---|---|
Similarity: | 112/199 - (56%) | Gaps: | 11/199 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 KVIILGDSSVGKTSLMNQYVNKRF-SNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSL 73
Fly 74 GVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTRR 138
Fly 139 AQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQNNRPGNPD 203
Fly 204 NCQC 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab7 | NP_001247276.1 | Rab7 | 9..179 | CDD:206655 | 68/169 (40%) |
RAB | 9..174 | CDD:197555 | 66/164 (40%) | ||
rab-37 | NP_001041294.1 | RAB | 30..192 | CDD:197555 | 67/166 (40%) |
Rab | 30..187 | CDD:206640 | 65/161 (40%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |