DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and arl-8

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_502791.1 Gene:arl-8 / 178405 WormBaseID:WBGene00000192 Length:185 Species:Caenorhabditis elegans


Alignment Length:166 Identity:47/166 - (28%)
Similarity:84/166 - (50%) Gaps:12/166 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERF 70
            |..:::.::|..:.|||:.:|...:.:|:.....|:|  |..:::...:  ||:::||..||.||
 Worm    18 KEEMELTLVGLQNSGKTTFVNVIASGQFTEDMIPTVG--FNMRKITKGN--VTIKLWDIGGQPRF 78

  Fly    71 QSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVD----LDN 131
            :|:...:.||.:..|.:.|..   ..:.|::.|:|.:........|..|.:|||||.|    ||.
 Worm    79 RSMWERYCRGVNAIVFMVDAA---DEEKLEASRNELMQLLDKPQLDAIPVLVLGNKKDLPGALDE 140

  Fly   132 RQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQ 167
            ||:..|......|:: :|..|..|.||..|:::..|
 Worm   141 RQLIERMNLSSIQNR-EICCYSISCKEKENIDITLQ 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 46/163 (28%)
RAB 9..174 CDD:197555 46/163 (28%)
arl-8NP_502791.1 Arl10_like 22..180 CDD:206724 46/162 (28%)
Ras 23..178 CDD:278499 46/161 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.