DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and rab-35

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_499454.1 Gene:rab-35 / 176560 WormBaseID:WBGene00004284 Length:209 Species:Caenorhabditis elegans


Alignment Length:216 Identity:80/216 - (37%)
Similarity:119/216 - (55%) Gaps:17/216 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRK--KSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWD 63
            |:|.:  ..|.|::|:|||.|||:||:.::.:..||..|..|||.||..:.:.:|.:.|.:||||
 Worm     1 MAGTRDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSENYITTIGVDFKIRTMDINGQRVKLQIWD 65

  Fly    64 TAGQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVD 128
            |||||||:::...:|||....|:|||||...||.|:..|     :|....:.|....|::|||.:
 Worm    66 TAGQERFRTITSTYYRGTHGVVVVYDVTNGESFGNVKRW-----LQEIENNCDSVQKVLVGNKCE 125

  Fly   129 LDNRQVSTRR-AQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAE-AEVINDFPDQ-- 189
            .:.|:|.... |:.:.||.| |.::||||||..|||..|..|  .:|.|.|: |...:...||  
 Worm   126 ENERRVVLESDARNYAQSMN-ISFFETSAKEDKNVEPMFTCI--TSLVLTAKLANPQSASKDQSR 187

  Fly   190 ---ITLGSQNNRPGNPDNCQC 207
               ::|...:........|:|
 Worm   188 TGGVSLKDNSGSTNQKKKCKC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 70/170 (41%)
RAB 9..174 CDD:197555 68/165 (41%)
rab-35NP_499454.1 Rab35 5..208 CDD:133310 77/210 (37%)
RAB 11..171 CDD:197555 69/167 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.