DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and rheb-1

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_499079.1 Gene:rheb-1 / 176327 WormBaseID:WBGene00010038 Length:207 Species:Caenorhabditis elegans


Alignment Length:216 Identity:54/216 - (25%)
Similarity:93/216 - (43%) Gaps:28/216 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAG 66
            |.|:....||.::|...|||::|:.::....|..:|::|| .|..:|.:....|...:::.||||
 Worm     7 SNRQSLNRKVAVMGYPHVGKSALVLRFTQNIFPERYESTI-EDQHSKHIAAFHRDYHLRVTDTAG 70

  Fly    67 QERFQSLGVAFYRGADC----CVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKV 127
            |:.:    ..|.|....    .:|||.:....||:...:..::.:   ........|.|::|||.
 Worm    71 QQEY----TVFPRSCSLDINGFILVYAIDDRKSFEMCSNIYEKIV---RTYGDTSIPIVIVGNKT 128

  Fly   128 DLDNRQV-----STRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFP 187
            ||..::|     ....|:||     |..:.|.:|:|...|...|:::.:     |.|....|..|
 Worm   129 DLSTQRVVRAEEGEELARQW-----DAKFVEITARESNRVHEVFELLLR-----EIEISRGNLSP 183

  Fly   188 DQITLGSQNNR-PGNPDNCQC 207
            .:...|:...| |...|...|
 Worm   184 TERPNGNSPKRNPFKDDGKPC 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 44/178 (25%)
RAB 9..174 CDD:197555 43/173 (25%)
rheb-1NP_499079.1 RheB 13..207 CDD:206709 52/210 (25%)
small_GTPase 13..177 CDD:197466 45/181 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.