DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and ral-1

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001254866.1 Gene:ral-1 / 175433 WormBaseID:WBGene00021811 Length:254 Species:Caenorhabditis elegans


Alignment Length:163 Identity:55/163 - (33%)
Similarity:87/163 - (53%) Gaps:15/163 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLG 74
            |||::|...|||::|..|::...|..:|:.| .||...|:||::....::.|.||||||.:.::.
 Worm    60 KVIMVGTGGVGKSALTLQFMYDEFVEEYEPT-KADSYRKKVVLDGEECSIDILDTAGQEDYSAIR 123

  Fly    75 VAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL-DNRQVST-- 136
            ..:||..:..:.|:.:....||:..:.:|::.|  .........|.|::|||.|: |.|.||.  
 Worm   124 DNYYRSGEGFICVFSILDMESFEATNEFREQIL--RVKNSDSSVPIVLVGNKGDMRDQRVVSAEL 186

  Fly   137 --RRAQQW-CQSKNDIPYYETSAKEGINVEMAF 166
              :||:|| |.      |.|||||...||:..|
 Worm   187 CRQRAEQWGCH------YVETSAKRRENVDKVF 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 55/163 (34%)
RAB 9..174 CDD:197555 55/163 (34%)
ral-1NP_001254866.1 RAS 59..223 CDD:214541 55/163 (34%)
RalA_RalB 59..222 CDD:206710 55/163 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.