DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and rab-7

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_496549.1 Gene:rab-7 / 174834 WormBaseID:WBGene00004271 Length:209 Species:Caenorhabditis elegans


Alignment Length:209 Identity:151/209 - (72%)
Similarity:175/209 - (83%) Gaps:4/209 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSG-RKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDT 64
            ||| |||:||||||||||.||||||||||||:||||||||||||||.|::|.::||.||:|||||
 Worm     1 MSGTRKKALLKVIILGDSGVGKTSLMNQYVNRRFSNQYKATIGADFLTRDVNIDDRTVTLQIWDT 65

  Fly    65 AGQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL 129
            ||||||||||||||||||||||.:|||...|||:|||||||||||||||||||||||:|||||||
 Worm    66 AGQERFQSLGVAFYRGADCCVLAFDVTNAASFKSLDSWRDEFLIQASPRDPDHFPFVLLGNKVDL 130

  Fly   130 DN-RQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEA-EAEVINDFPDQITL 192
            :: |.||::|||.|||:|.:|||||.||||.:|||.||..||::||..|: |.....:|||||.|
 Worm   131 ESQRAVSSKRAQSWCQTKGNIPYYEVSAKEALNVEAAFLAIARDALARESQETNDFPEFPDQIRL 195

  Fly   193 G-SQNNRPGNPDNC 205
            . :|.|:..:..||
 Worm   196 NPNQQNQQNSGCNC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 133/171 (78%)
RAB 9..174 CDD:197555 130/165 (79%)
rab-7NP_496549.1 Rab7 10..181 CDD:206655 133/170 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 271 1.000 Domainoid score I953
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100564
Inparanoid 1 1.050 296 1.000 Inparanoid score I1661
Isobase 1 0.950 - 0 Normalized mean entropy S534
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 1 1.000 - - FOG0001661
OrthoInspector 1 1.000 - - oto18489
orthoMCL 1 0.900 - - OOG6_101358
Panther 1 1.100 - - LDO PTHR47981
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2001
SonicParanoid 1 1.000 - - X1058
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.850

Return to query results.
Submit another query.