DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and unc-108

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001343725.1 Gene:unc-108 / 171956 WormBaseID:WBGene00006833 Length:223 Species:Caenorhabditis elegans


Alignment Length:198 Identity:71/198 - (35%)
Similarity:117/198 - (59%) Gaps:6/198 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
            |.|.||:||:.|||:.|:.|:.:|||...:..|||.:|..:.|.::.:.:.:|||||||||.|:|
 Worm    15 LFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDGKQIKLQIWDTAGQESFRS 79

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTR 137
            :..::||||...:||||:|..::|.:|.||.::    |......:...:::|||.||:.|:...|
 Worm    80 ITRSYYRGAAGALLVYDITRRDTFNHLTSWLED----ARQHSNSNMVIMLIGNKSDLEARREVKR 140

  Fly   138 RAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNAL-ELEAEAEVINDFPDQITLGSQNNRPGN 201
            ...:....::.:.:.|||||...|||.||...||... :::.....||:..:.|.||.|:: |.:
 Worm   141 EEGEAFAREHGLVFMETSAKTAANVEEAFIDTAKEIYRKIQEGVFDINNEANGIKLGPQHS-PSS 204

  Fly   202 PDN 204
            |::
 Worm   205 PNS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 62/170 (36%)
RAB 9..174 CDD:197555 62/164 (38%)
unc-108NP_001343725.1 Ras 10..202 CDD:331851 69/191 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.