DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rab3c

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_598220.1 Gene:Rab3c / 171058 RGDID:620923 Length:227 Species:Rattus norvegicus


Alignment Length:224 Identity:77/224 - (34%)
Similarity:120/224 - (53%) Gaps:33/224 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GRKKS-------LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQ 60
            |:|.|       :.|::|:|:|||||||.:.:|.:..|::.:.:|:|.||..|.|..|::.:.:|
  Rat    18 GQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQ 82

  Fly    61 IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGN 125
            |||||||||::::..|:||||...:|:||:|...||..:..|.    .|......|:...:::||
  Rat    83 IWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWS----TQIKTYSWDNAQVILVGN 143

  Fly   126 KVDL-DNRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQ-----VIAKNALELEAEAEVIN 184
            |.|: |.|.|||.|.:...:... ..::|||||:.|||:..|:     :..|.:..||.:     
  Rat   144 KCDMEDERVVSTERGRHLGEQLG-FEFFETSAKDNINVKQTFERLVDIICDKMSESLETD----- 202

  Fly   185 DFPDQITLGSQNNR------PGNPDNCQC 207
               ..||...|:.|      |..| ||.|
  Rat   203 ---PAITGAKQSTRLKETPPPPQP-NCGC 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 65/175 (37%)
RAB 9..174 CDD:197555 63/170 (37%)
Rab3cNP_598220.1 Rab3 30..194 CDD:206657 62/168 (37%)
RAB 31..191 CDD:197555 62/164 (38%)
Effector region. /evidence=ECO:0000250 59..67 2/7 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..227 8/33 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.