DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rab3d

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_006242655.1 Gene:Rab3d / 140665 RGDID:620924 Length:239 Species:Rattus norvegicus


Alignment Length:208 Identity:63/208 - (30%)
Similarity:111/208 - (53%) Gaps:18/208 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
            :.|::::|:|||||||.:.:|.:..|:..:.:|:|.||..|.|..:|:.:.:||||||||||:::
  Rat    42 MFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRT 106

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTR 137
            :..|:||||...:|:||:....||..:..|    ..|......|:...:::|||.||::.:|.:.
  Rat   107 ITTAYYRGAMGFLLMYDIANQESFTAVQDW----ATQIKTYSWDNAQVILVGNKCDLEDERVVSA 167

  Fly   138 RAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQNNR---- 198
            ...|.........::|.||||.|||:..|:.:      ::...:.:|:..:..:....|.:    
  Rat   168 EDGQRLAGDLGFEFFEASAKENINVKQVFERL------VDIICDKMNESLEPSSSPGSNGKGPAL 226

  Fly   199 ----PGNPDNCQC 207
                |..|.:|.|
  Rat   227 GDTPPPQPSSCGC 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 57/169 (34%)
RAB 9..174 CDD:197555 57/164 (35%)
Rab3dXP_006242655.1 Rab3 42..206 CDD:206657 57/173 (33%)
RAB 43..203 CDD:197555 57/169 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.