DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and AgaP_AGAP001874

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_003435963.1 Gene:AgaP_AGAP001874 / 1281247 VectorBaseID:AGAP001874 Length:184 Species:Anopheles gambiae


Alignment Length:198 Identity:58/198 - (29%)
Similarity:96/198 - (48%) Gaps:21/198 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLG 74
            |:::||...|||::|..|:|...|..:|..|| .|...|:|.|:.:...::|.||||.|:|.::.
Mosquito     5 KIVVLGSGGVGKSALTVQFVQGIFVEKYDPTI-EDSYRKQVEVDGQQCMLEILDTAGTEQFTAMR 68

  Fly    75 VAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTRRA 139
            ..:.:.....||||.:||.::|.:|...|::.|   ..:|.|..|.|::|||.||::.:|..:..
Mosquito    69 DLYMKNGQGFVLVYSITAQSTFNDLQDLREQIL---RVKDTDDVPMVLVGNKCDLEDERVVGKDL 130

  Fly   140 QQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQNNRPGNPDN 204
            .:...::.:..:.|||||..|||.                 ::..|...||...|...:|.....
Mosquito   131 GRSLAAQFNCAFMETSAKAKINVN-----------------DIFYDLVQQINKKSPERKPNKKKK 178

  Fly   205 CQC 207
            ..|
Mosquito   179 SLC 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 52/168 (31%)
RAB 9..174 CDD:197555 52/163 (32%)
AgaP_AGAP001874XP_003435963.1 small_GTPase 2..167 CDD:197466 55/182 (30%)
Rap1 3..166 CDD:133375 55/181 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.