DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and AgaP_AGAP012108

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_320421.3 Gene:AgaP_AGAP012108 / 1280568 VectorBaseID:AGAP012108 Length:204 Species:Anopheles gambiae


Alignment Length:165 Identity:58/165 - (35%)
Similarity:94/165 - (56%) Gaps:14/165 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQ 71
            :|.|||::|...|||::|..|::...|...|:.| .||...|:||::...|.:.|.||||||.:.
Mosquito    13 ALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPT-KADSYRKKVVLDGEEVQIDILDTAGQEDYA 76

  Fly    72 SLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL-DNRQV- 134
            ::...::|..:..:.|:.:|..:||:....:|::.|   ..::.::.||:::|||.|| |.|:| 
Mosquito    77 AIRDNYFRSGEGFLCVFSITEDDSFQATQEFREQIL---RVKNDENIPFLLVGNKCDLNDKRKVP 138

  Fly   135 ---STRRAQQWCQSKNDIPYYETSAKEGINVEMAF 166
               ...|||||     .:||.|||||...||:..|
Mosquito   139 LAECQSRAQQW-----GVPYVETSAKTRENVDKVF 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 57/163 (35%)
RAB 9..174 CDD:197555 57/163 (35%)
AgaP_AGAP012108XP_320421.3 RalA_RalB 15..177 CDD:206710 57/163 (35%)
small_GTPase 15..176 CDD:197466 57/163 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.