DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and AgaP_AGAP012348

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_320205.2 Gene:AgaP_AGAP012348 / 1280358 VectorBaseID:AGAP012348 Length:276 Species:Anopheles gambiae


Alignment Length:214 Identity:51/214 - (23%)
Similarity:90/214 - (42%) Gaps:64/214 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVV---------NDRVVTMQIWDT 64
            :||:|.||.:|||:.|:.:...|.|..||..       |:::.|         .|.||.:::||.
Mosquito    43 MKVVIKGDRNVGKSCLLERLQGKAFIEQYTP-------TEQIQVASIQWSFKATDDVVKVEVWDV 100

  Fly    65 A--GQERFQSLGVAF---------------------YRGADCCVLVYDVTAPNSFKNLDSWRDEF 106
            .  |:.:.:|..:..                     |:|..|.|:|.|:|        .:|..::
Mosquito   101 VDRGKSKQKSTNLKLTTAGAGAEPDIPVLDAEFLDVYKGTHCVVMVMDIT--------KAWTFDY 157

  Fly   107 LIQASPRDPDHFPFVVLGNKVDLDNRQVST--------RRAQQWCQSKNDIPYYETSAKEGINVE 163
            :.:..|:.|...|.::|||..|:.:.:|.|        ..|.|  :.|.:|.|.::|.:.|..:.
Mosquito   158 VCRELPKVPTDIPVLLLGNHCDMGHHRVITAEQVHGFVETASQ--ERKAEIVYGDSSMRNGFGLR 220

  Fly   164 M-------AFQVIAKNALE 175
            :       .|..:.|:|||
Mosquito   221 LLHKFFGIPFLYLQKSALE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 51/214 (24%)
RAB 9..174 CDD:197555 48/211 (23%)
AgaP_AGAP012348XP_320205.2 P-loop_NTPase 43..196 CDD:304359 39/167 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.