DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and AgaP_AGAP009846

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_318959.3 Gene:AgaP_AGAP009846 / 1279264 VectorBaseID:AGAP009846 Length:233 Species:Anopheles gambiae


Alignment Length:204 Identity:89/204 - (43%)
Similarity:117/204 - (57%) Gaps:11/204 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQER 69
            |..||||:||||.:|||:.|||::|:..|......|||.:|..|::.|:....|:||||||||||
Mosquito     9 KNILLKVVILGDGNVGKSCLMNRFVSNYFDANSFHTIGVEFLNKDIQVDQERFTLQIWDTAGQER 73

  Fly    70 FQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLD--NR 132
            |::|...||||.|.|:|.|.:....||:.|.||||||| :....:||||||||:|.|.||.  .|
Mosquito    74 FRALRTPFYRGTDICLLTYAINDRLSFRALVSWRDEFL-RYYDVNPDHFPFVVVGTKNDLPPAQR 137

  Fly   133 QVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAK--------NALELEAEAEVINDFPDQ 189
            :|:.....||||..:...|.|||||...||..||.:..:        ...||.|:.:...|....
Mosquito   138 EVTAEEVSQWCQEHHITAYIETSAKTSENVATAFALAVQQWRKLERSTERELRAQGQDTIDLMKS 202

  Fly   190 ITLGSQNNR 198
            :.|.:..||
Mosquito   203 VNLNANRNR 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 82/179 (46%)
RAB 9..174 CDD:197555 80/174 (46%)
AgaP_AGAP009846XP_318959.3 P-loop_NTPase 9..178 CDD:304359 82/169 (49%)
Ras 14..177 CDD:278499 79/163 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101401at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.