DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and AgaP_AGAP007901

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_317585.4 Gene:AgaP_AGAP007901 / 1278055 VectorBaseID:AGAP007901 Length:228 Species:Anopheles gambiae


Alignment Length:198 Identity:74/198 - (37%)
Similarity:109/198 - (55%) Gaps:13/198 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLG 74
            |:::||:|:|||:||:.::|..:|....::||||.|.|:.:.::|..|..:|||||||||:.||.
Mosquito    31 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTLCIDDTTVKFEIWDTAGQERYHSLA 95

  Fly    75 VAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVSTRR 138
            ..:||||...::|||:...:||....:|..|...||||    :....:.|||.||.| |.|....
Mosquito    96 PMYYRGAQAAIVVYDIQNSDSFARAKTWVKELQRQASP----NIVIALAGNKADLANSRVVDYEE 156

  Fly   139 AQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQNNRPG--N 201
            |:|:... |.:.:.|||||..:||...|..|.:.|....||     ..|.:..|..:|....  |
Mosquito   157 AKQYADD-NGLLFMETSAKTAVNVNDIFLAIGECASHCVAE-----HLPSEWNLAHENTTVAARN 215

  Fly   202 PDN 204
            |:|
Mosquito   216 PEN 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 66/169 (39%)
RAB 9..174 CDD:197555 65/164 (40%)
AgaP_AGAP007901XP_317585.4 Rab5_related 29..188 CDD:206653 65/161 (40%)
Ras 31..188 CDD:278499 65/161 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.