DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and AgaP_AGAP006025

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_316064.3 Gene:AgaP_AGAP006025 / 1276691 VectorBaseID:AGAP006025 Length:197 Species:Anopheles gambiae


Alignment Length:201 Identity:56/201 - (27%)
Similarity:100/201 - (49%) Gaps:17/201 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTK-EVVVNDRVVTMQIWDTAGQERFQS 72
            :||.::|...|||::|..:::.||:..:|...  |:...| |::|:...|..:||||..:....:
Mosquito     4 IKVAVIGAPCVGKSALTVRFLTKRYIGEYDHQ--AENRHKYEIMVDGEAVLCEIWDTCPKALSLT 66

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVST 136
            .|....:.||..:|||.:|..:||        .|:.:|........|..::|||||:.: |||||
Mosquito    67 AGSETVQWADGLLLVYSITDRDSF--------NFIRRAKEELAGDLPVALVGNKVDMVHLRQVST 123

  Fly   137 RRAQQWCQSKN-DIPYYETSAKEGI-NVEMAFQVIAKNALELEAEA-EVINDFPDQITLGSQNNR 198
            ...:  ..:|: :..::|.||.|.: .|..||..:.:..|..:.:: :...|..|::..||:...
Mosquito   124 DEGE--ILAKDFECKFFEISAAEHVYQVAEAFLELCREVLTGKRKSKQSFIDKIDRMLSGSRTYS 186

  Fly   199 PGNPDN 204
            .|..|:
Mosquito   187 RGKSDS 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 50/173 (29%)
RAB 9..174 CDD:197555 49/168 (29%)
AgaP_AGAP006025XP_316064.3 Ras 5..161 CDD:278499 49/167 (29%)
P-loop_NTPase 5..160 CDD:304359 49/166 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.