DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and AgaP_AGAP005248

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_314163.4 Gene:AgaP_AGAP005248 / 1274961 VectorBaseID:AGAP005248 Length:280 Species:Anopheles gambiae


Alignment Length:180 Identity:48/180 - (26%)
Similarity:89/180 - (49%) Gaps:10/180 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSL 73
            ::::|||.:.|||:.::.:::.|.:|::|:.|: .|...:|..:....:.:.|.||:|:.:|.::
Mosquito     7 IRLVILGGAGVGKSCIIKRFLFKTYSDKYRPTV-EDLYNREYDLGSVTLKVDILDTSGEMQFPAM 70

  Fly    74 GVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL--DNRQVST 136
            .......|...:|||..|:..|...:....:|  |:....|....|.|::|||.||  .:|:|..
Mosquito    71 RRLSIATAHAFLLVYATTSEASLGCVKQCFEE--IREQRADFQDIPMVIVGNKYDLTASHREVRI 133

  Fly   137 RRAQQW--CQ-SKNDIPYYETSAKEGINVEMAFQ--VIAKNALELEAEAE 181
            ....:|  |: .|..:...|.|||:..|:...|:  |.....|.:...||
Mosquito   134 EDVSEWVFCELPKLKVKVLECSAKDDYNIMEIFRTFVTLSRILPVNGSAE 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 46/176 (26%)
RAB 9..174 CDD:197555 45/171 (26%)
AgaP_AGAP005248XP_314163.4 Ras 8..172 CDD:206642 45/166 (27%)
small_GTPase 8..170 CDD:197466 44/164 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.