DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and AgaP_AGAP004559

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_001238825.3 Gene:AgaP_AGAP004559 / 1274700 VectorBaseID:AGAP004559 Length:215 Species:Anopheles gambiae


Alignment Length:200 Identity:69/200 - (34%)
Similarity:120/200 - (60%) Gaps:11/200 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
            |.||:::|||.|||::|::::....|:.:.|:|||.:|.|:.:.|:.:.:..||||||||||:::
Mosquito    11 LFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQERYRA 75

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVST 136
            :..|:||||...:||||:....:::|::.|..|....|.    .:...:::|||.||.: |.|.|
Mosquito    76 ITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHAD----QNIVIMLVGNKSDLRHLRAVPT 136

  Fly   137 RRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPD----QITLGSQNN 197
            ..|:.:.: :|.:.:.||||.:..|||.|||.|......:.::.: |.|.|:    :..|.:.:.
Mosquito   137 DEAKGFAE-RNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQ-IRDPPEGSVIRPNLENIDV 199

  Fly   198 RPGNP 202
            :|.||
Mosquito   200 KPTNP 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 61/170 (36%)
RAB 9..174 CDD:197555 61/165 (37%)
AgaP_AGAP004559XP_001238825.3 Rab11_like 9..173 CDD:206660 62/166 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.