DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and AgaP_AGAP000671

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_311197.3 Gene:AgaP_AGAP000671 / 1272433 VectorBaseID:AGAP000671 Length:204 Species:Anopheles gambiae


Alignment Length:186 Identity:68/186 - (36%)
Similarity:111/186 - (59%) Gaps:7/186 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
            |.|::::|||.||||.::.::.:..|::.:.:|||.||..|.:.:..:.:.:|||||||||||.:
Mosquito     9 LFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTIELRGKKIKLQIWDTAGQERFHT 73

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL-DNRQVST 136
            :..::||||...:||||:|...||.|:..|    |........:....::||||.|: |.|.|..
Mosquito    74 ITTSYYRGAMGIMLVYDITNEKSFDNIVKW----LRNIDEHANEDVEKMILGNKCDMADKRAVRK 134

  Fly   137 RRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITL 192
            .|.:...: ::||.:.|||||...|:|:||:.:|:..|:..|..|. .|.||::.:
Mosquito   135 ERGENIAR-EHDIRFMETSAKANTNIELAFRELAEAILDKVAGKET-TDNPDRVVV 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 62/170 (36%)
RAB 9..174 CDD:197555 61/165 (37%)
AgaP_AGAP000671XP_311197.3 Rab8_Rab10_Rab13_like 7..173 CDD:206659 63/168 (38%)
RAB 10..173 CDD:197555 62/167 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.