DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and AgaP_AGAP007096

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_308662.1 Gene:AgaP_AGAP007096 / 1270007 VectorBaseID:AGAP007096 Length:220 Species:Anopheles gambiae


Alignment Length:204 Identity:71/204 - (34%)
Similarity:113/204 - (55%) Gaps:11/204 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
            |.|::::||...|||.::.::.:..|...:..|||.||..|.|.|:.:.|.:|||||||||||::
Mosquito    21 LFKIVLIGDCGTGKTCIVQRFKSGNFIESHGNTIGVDFSMKAVSVDGKKVKLQIWDTAGQERFRT 85

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLD-NRQVST 136
            :..::||.|:..::|||:|..::|.:|..|.||.....:    .:....|:|||.||| .|:|..
Mosquito    86 ITQSYYRSANGVLIVYDITKRSTFLSLQRWIDEVRRYTA----SNVMIFVIGNKSDLDEEREVEF 146

  Fly   137 RRAQQWCQSKNDIPY-YETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQ--ITLGSQNNR 198
            ..|:..||...::.: .|||||:...|:.||..:   |.||:...:.:|...::  ||||...:.
Mosquito   147 SEAENLCQYIPEVMFVMETSAKDNRCVDDAFMTL---ATELKRRHDGLNAAEEEEGITLGQSKSL 208

  Fly   199 PGNPDNCQC 207
            ..|..|..|
Mosquito   209 STNTCNSLC 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 62/171 (36%)
RAB 9..174 CDD:197555 59/166 (36%)
AgaP_AGAP007096XP_308662.1 P-loop_NTPase 19..184 CDD:304359 61/169 (36%)
RAB 22..187 CDD:197555 62/171 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.