DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and AgaP_AGAP007654

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_308216.2 Gene:AgaP_AGAP007654 / 1269573 VectorBaseID:AGAP007654 Length:215 Species:Anopheles gambiae


Alignment Length:212 Identity:63/212 - (29%)
Similarity:114/212 - (53%) Gaps:12/212 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVN---DRVVTMQIWDTA 65
            :::.|.|::::|:...||||.:.:||::.||..|:||||.||..|  |:|   :.::.:|:||.|
Mosquito     8 KREHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALK--VLNWDQNTIIRLQLWDIA 70

  Fly    66 GQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLD 130
            |||||.::...:|:.|....:|:|||...:|..:..|:::...:....|....|.::|.||.|..
Mosquito    71 GQERFGNMTRVYYKEAVGAFIVFDVTRSATFDAVIKWKNDLDSKVQLPDGKPIPCILLANKSDQQ 135

  Fly   131 NRQVSTRRAQ--QWCQSKNDIPYYETSAKEGINVEMAFQVIAKNAL---ELEAEAEVINDFPDQI 190
            .:.:.|..|:  ::.:......::||||||.:|:|.|.:.:....|   :|....|||:.  ::.
Mosquito   136 KQGIVTTPAKLDEYVKEHGFAGWFETSAKENVNIEEAAKSLVNKILMNDKLLNTGEVIDS--ERF 198

  Fly   191 TLGSQNNRPGNPDNCQC 207
            .|....:......:|.|
Mosquito   199 ALVGGKSDTSQKKSCSC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 56/177 (32%)
RAB 9..174 CDD:197555 54/169 (32%)
AgaP_AGAP007654XP_308216.2 Rab32_Rab38 13..213 CDD:206692 60/203 (30%)
RAB 13..181 CDD:197555 54/169 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.