DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rheb

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster


Alignment Length:199 Identity:56/199 - (28%)
Similarity:91/199 - (45%) Gaps:31/199 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLGV 75
            :.::|..||||:||..|:|..:|.:.|..||...| ||...|..:...:::.|||||:.:....|
  Fly     8 IAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTF-TKIERVKSQDYIVKLIDTAGQDEYSIFPV 71

  Fly    76 AF---YRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL-DNRQVST 136
            .:   |.|   .||||.:|:..||:.:....::.|.....:   :.|.|::|||:|| ..|.|||
  Fly    72 QYSMDYHG---YVLVYSITSQKSFEVVKIIYEKLLDVMGKK---YVPVVLVGNKIDLHQERTVST 130

  Fly   137 RRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQNNRPGN 201
            ...::..:|.. ..:.|||||:..:|...|..:.                   |.:.::|..|..
  Fly   131 EEGKKLAESWR-AAFLETSAKQNESVGDIFHQLL-------------------ILIENENGNPQE 175

  Fly   202 PDNC 205
            ...|
  Fly   176 KSGC 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 52/171 (30%)
RAB 9..174 CDD:197555 52/166 (31%)
RhebNP_730950.2 RheB 5..182 CDD:206709 56/199 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.