DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Rab7 and tnks

DIOPT Version :9

Sequence 1:	NP_001247276.1	Gene:	Rab7 / 42841	FlyBaseID:	FBgn0015795	Length:	207	Species:	Drosophila melanogaster
Sequence 2:	XP_004911090.1	Gene:	tnks / 100497226	XenbaseID:	XB-GENE-5828012	Length:	1306	Species:	Xenopus tropicalis

Alignment Length:	172	Identity:	32/172 - (18%)
Similarity:	57/172 - (33%)	Gaps:	60/172 - (34%)

- Green bases have known domain annotations that are detailed below.

  Fly     4 RKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEV--VVNDRVVTMQIWDTAG 66
            ::|.:.::::...:||.:.       ||.|.....  :.|:....:|  |::.....|...||.|
Frog   514 KRKQITELLLRKGASVNEK-------NKDFMTPLH--VAAERAHNDVVEVLHKHGAKMNALDTLG 569

  Fly    67 QERFQSLGVAFYRGA-----DCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNK 126
            |       .|.:|.|     ..|.|:....:..|..:|..                |....:||:
Frog   570 Q-------TALHRAALGGHLQTCRLLLSFGSDASIVSLQG----------------FTAAQMGNE 611

  Fly   127 V---------------DLDNRQVSTRRA------QQWCQSKN 147
            .               |:|.|.:...:|      :|.|.|:|
Frog   612 AVQQILNVESTPVRTSDVDYRLLEASKAGDLDTVKQLCSSQN 653

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Rab7	NP_001247276.1	Rab7	9..179	CDD:206655	31/167 (19%)
Rab7	NP_001247276.1	RAB	9..174	CDD:197555	31/167 (19%)
tnks	XP_004911090.1	Ank_4	164..214	CDD:290365
		ANK	186..300	CDD:238125
		ANK repeat	196..224	CDD:293786
		Ank_2	198..290	CDD:289560
		ANK repeat	226..257	CDD:293786
		ANK repeat	259..290	CDD:293786
		Ank_4	317..367	CDD:290365
		ANK	339..453	CDD:238125
		ANK repeat	349..377	CDD:293786
		Ank_2	351..443	CDD:289560
		ANK repeat	379..410	CDD:293786
		ANK repeat	412..443	CDD:293786
		ANK repeat	501..533	CDD:293786	3/25 (12%)
		Ank_2	504..598	CDD:289560	20/99 (20%)
		ANK	530..716	CDD:238125	29/156 (19%)
		ANK repeat	535..566	CDD:293786	5/32 (16%)
		ANK repeat	568..598	CDD:293786	8/36 (22%)
		ANK	655..780	CDD:238125
		ANK repeat	665..693	CDD:293786
		Ank_2	667..759	CDD:289560
		ANK repeat	695..726	CDD:293786
		ANK repeat	728..759	CDD:293786
		ANK repeat	781..811	CDD:293786
		Ank_4	782..836	CDD:290365
		ANK	808..932	CDD:238125
		ANK repeat	815..846	CDD:293786
		Ank_2	820..912	CDD:289560
		ANK repeat	848..879	CDD:293786
		ANK repeat	881..912	CDD:293786
		SAM_tankyrase1,2	1003..1068	CDD:188923
		SAM	1009..1066	CDD:197735
		tankyrase_like	1070..1292	CDD:238718
		PARP	1090..1287	CDD:279038
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0394
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900