DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and XB5873314

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_004916872.1 Gene:XB5873314 / 100496061 XenbaseID:XB-GENE-5873315 Length:210 Species:Xenopus tropicalis


Alignment Length:187 Identity:62/187 - (33%)
Similarity:105/187 - (56%) Gaps:5/187 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVN---DRVVTMQIWD 63
            |.:::.|.||:::||..|||||::.:||:..||..|:||||.||..|  :||   :.:|.:|:||
 Frog     4 SPQREILCKVLVVGDLGVGKTSIIQRYVHNVFSQCYRATIGVDFALK--IVNWDLNTMVRLQLWD 66

  Fly    64 TAGQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVD 128
            .||||||..:...:||.|...::|.|:....:.:::..|:::...:...::.:..|.::||||.|
 Frog    67 IAGQERFGHMTRLYYREAVGALVVCDLGRVATVESVSRWKEDLDSKVCLQNGNPIPVILLGNKCD 131

  Fly   129 LDNRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVIND 185
            ......|....:|..:.......:.|||||.:|:|||...:.|..:..:.:.|..||
 Frog   132 QVPLGTSASNLEQLGEELGFSHSHMTSAKENVNIEMAISSLIKEMIANDEDYEPRND 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 57/172 (33%)
RAB 9..174 CDD:197555 57/167 (34%)
XB5873314XP_004916872.1 Rab32_Rab38 12..207 CDD:206692 60/179 (34%)
RAB 12..179 CDD:197555 57/168 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.