DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rab37

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_008766630.1 Gene:Rab37 / 100364984 RGDID:2319982 Length:223 Species:Rattus norvegicus


Alignment Length:191 Identity:76/191 - (39%)
Similarity:110/191 - (57%) Gaps:20/191 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVIILGDSSVGKTSLMNQYVNKRF-SNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSL 73
            ||::||||.||||..:.|:.:..| |..:.||:|.||..|.|.|:...|.:|||||||||||:|:
  Rat    31 KVMLLGDSGVGKTCFLIQFKDGAFLSGTFIATVGIDFRNKVVTVDGARVKLQIWDTAGQERFRSV 95

  Fly    74 GVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTRR 138
            ..|:||.|...:|:||:|..:||.|:.:|..| :.:.:.||   ...::||||.|:.:.:|....
  Rat    96 THAYYRDAQALLLLYDITNQSSFDNIRAWLTE-IHEYAQRD---VVIMLLGNKADVSSERVIRSE 156

  Fly   139 AQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQNNRP 199
            ..:....:..:|:.|||||.|:|||:||..|||   ||:..|            |.|.:.|
  Rat   157 DGETLAREYGVPFMETSAKTGMNVELAFLAIAK---ELKYRA------------GKQPDEP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 72/169 (43%)
RAB 9..174 CDD:197555 70/164 (43%)
Rab37XP_008766630.1 Rab26 31..220 CDD:206695 76/191 (40%)
RAB 31..192 CDD:197555 71/167 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.