DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rab5al1

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_003751425.1 Gene:Rab5al1 / 100361891 RGDID:2319287 Length:215 Species:Rattus norvegicus


Alignment Length:207 Identity:78/207 - (37%)
Similarity:111/207 - (53%) Gaps:9/207 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAG 66
            :|.|....|:::||:|:|||:||:.::|..:|....::||||.|.|:.|.::|..|..:||||||
  Rat    14 TGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAG 78

  Fly    67 QERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN 131
            |||:.||...:||||...::|||:|...||....:|..|...||||    :....:.|||.||.|
  Rat    79 QERYHSLAPMYYRGAQAAIVVYDITNEESFSRAKNWVKELQRQASP----NIVIALSGNKADLAN 139

  Fly   132 -RQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQ 195
             |.|..:.||.:... |.:.:.|||||..:||...|..|||...:.|.:....|....:   |..
  Rat   140 KRAVDFQEAQSYADD-NSLLFMETSAKTPMNVNEIFMAIAKKLPKNEPQNPGANSARGR---GVD 200

  Fly   196 NNRPGNPDNCQC 207
            ...|..|...||
  Rat   201 LTEPAQPARSQC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 70/170 (41%)
RAB 9..174 CDD:197555 69/165 (42%)
Rab5al1XP_003751425.1 Rab5_related 20..182 CDD:206653 69/166 (42%)
Ras 22..183 CDD:278499 69/165 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.