DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and cracr2aa

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_002667614.5 Gene:cracr2aa / 100330395 ZFINID:ZDB-GENE-110427-1 Length:718 Species:Danio rerio


Alignment Length:155 Identity:56/155 - (36%)
Similarity:90/155 - (58%) Gaps:4/155 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
            |.||:::|:||||||||:.::.:..|.:...||:|.|:..|.:.|::..:.:|:||||||||::|
Zfish   532 LFKVVLVGNSSVGKTSLLRRFCDDCFHSGTCATVGIDYSVKTLSVDNSQIALQMWDTAGQERYRS 596

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTR 137
            :...|:|.||..|:|||:|...:|..:..|    |........:..|.::||||.|||:::|...
Zfish   597 ITKQFFRKADGVVVVYDITNEQTFTAVRQW----LASVQEGAGEDIPIMLLGNKTDLDSQRVIPL 657

  Fly   138 RAQQWCQSKNDIPYYETSAKEGINV 162
            ...:.......:.:||.||....||
Zfish   658 GLGEKLAKDFQLMFYECSAFSNHNV 682

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 55/154 (36%)
RAB 9..174 CDD:197555 55/154 (36%)
cracr2aaXP_002667614.5 EF-hand_7 35..97 CDD:316058
SMC_N <162..>371 CDD:330553
Rab 533..691 CDD:206640 55/154 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.