DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13604 and TFC7

DIOPT Version :9

Sequence 1:NP_001262894.1 Gene:CG13604 / 42840 FlyBaseID:FBgn0039137 Length:763 Species:Drosophila melanogaster
Sequence 2:NP_014753.1 Gene:TFC7 / 854277 SGDID:S000005636 Length:435 Species:Saccharomyces cerevisiae


Alignment Length:266 Identity:69/266 - (25%)
Similarity:96/266 - (36%) Gaps:87/266 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   494 IYIMRHGERVDFTFGTWIPYCFDEFGNYMRKDLNMPKTLPRRKNSPEGWQNDSPLTNVGVYQANL 558
            |||.|||.|     ..|:|.     |.|       |..|       .|..:|.||...||.||..
Yeast     6 IYIARHGYR-----SNWLPE-----GPY-------PDPL-------TGIDSDVPLAEHGVQQAKE 46

  Fly   559 IGQALLEAQVQIDHVYCSPSYRCIQTCTSALEGLKLTGKQKIKLEPGLFEW-------------- 609
            :...||....|.:..:.||.|||::|.....:.|::    .:.||.|:.||              
Yeast    47 LAHYLLSLDNQPEAAFASPFYRCLETVQPIAKLLEI----PVYLERGIGEWYRPDRKPVIPVPAG 107

  Fly   610 ----MAWYPSGV-PDW---LTKNELTEAKFDVDLDYEPVQPASELTARLKESTEQFYERNHDVIL 666
                ..::|..: .:|   ||.||..|.:             .|:..|.|:....|.||      
Yeast   108 YEILSKFFPGVISQEWDSTLTPNEKGETE-------------QEMYMRFKKFWPLFIER------ 153

  Fly   667 QLLEQTTGN---ILVVAHATTLDTCSRQLTG-GVPR-STNELRQVIHKIPYCSL----------A 716
              :|:...|   ||:|.||.:.......|.| ..|| |.||....| :...|||          .
Yeast   154 --VEKEYPNVECILLVTHAASKIALGMSLLGYDNPRMSLNENGDKI-RSGSCSLDKYEILKKSYD 215

  Fly   717 TVEQVD 722
            |:::.|
Yeast   216 TIDETD 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13604NP_001262894.1 UBA_UBS3B 23..60 CDD:270486
SH3_UBASH3 275..333 CDD:212725
His_Phos_1 494..728 CDD:278716 69/266 (26%)
TFC7NP_014753.1 PhoE 5..186 CDD:223483 58/228 (25%)
TFIIIC_sub6 289..>368 CDD:402169
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344077
Domainoid 1 1.000 53 1.000 Domainoid score I2795
eggNOG 1 0.900 - - E1_COG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102745
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1080
TreeFam 00.000 Not matched by this tool.
65.640

Return to query results.
Submit another query.