DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13604 and FBP26

DIOPT Version :9

Sequence 1:NP_001262894.1 Gene:CG13604 / 42840 FlyBaseID:FBgn0039137 Length:763 Species:Drosophila melanogaster
Sequence 2:NP_012380.1 Gene:FBP26 / 853286 SGDID:S000003691 Length:452 Species:Saccharomyces cerevisiae


Alignment Length:431 Identity:77/431 - (17%)
Similarity:141/431 - (32%) Gaps:155/431 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 NPHETDELELRIGDYIYLNTEVVDSSSDGWAEGISWLTGSTGHLPV-NYTERTAESDAWTLHRVV 346
            |...||..:||         |:  ::.:...:.:::.|...|.:.| :.|..|.:...| |..:.
Yeast    68 NFENTDNFKLR---------EL--AAQNAIKDIVNFFTKEDGSVAVFDATNSTRKRRKW-LKDIC 120

  Fly   347 Q---LSKSVASSLTSAEDLDIVDGRSI-STEPDDRQNTAHPDIIEGSSFEESEQSVEKYLRQTLK 407
            :   :......|.::..:|.|.:.:.| ||.||  ...:.|.:.|....|...|....|  :.|.
Yeast   121 EKNNIQPMFLESWSNDHELIINNAKDIGSTSPD--YENSEPHVAEADFLERIRQYERFY--EPLD 181

  Fly   408 P--CLELPSVQLLNSHNLTHQHNPNTPTIEITTNMSSSSTSMSKQPVDEILVEPPAAQPPRPDDT 470
            |  ..::..::|:|...            |:..|  ...|.:..:.|..::              
Yeast   182 PQKDKDMTFIKLVNIIE------------EVVIN--KIRTYLESRIVFYVM-------------- 218

  Fly   471 LSVHSDHSLHPGSLDASHAKNRKIYIMRHGERVDFTFGTWIPYCFDEFGNYMRKDLNMPKTLPRR 535
                   ::.|        |.:.|::.||||.:                      .|:.|.:   
Yeast   219 -------NIRP--------KPKYIWLSRHGESI----------------------YNVEKKI--- 243

  Fly   536 KNSPEGWQNDSPLTNVGVYQANLIGQALLEAQVQIDHVYCSPSYRCIQTCTSALEGLKLTGKQKI 600
                   ..||.|:..|...|..:.|.:.|:..:|:....:.:.:..|...:.|...||..|...
Yeast   244 -------GGDSSLSERGFQYAKKLEQLVKESAGEINLTVWTSTLKRTQQTANYLPYKKLQWKALD 301

  Fly   601 KLEPGLFEWMAWYPSGVPDWLTKNELTEAKFDVDLDYEPVQPASELTARLKESTEQFYERNHD-- 663
            :|:           :||.|.:|              ||.::         ||..|.|..|::|  
Yeast   302 ELD-----------AGVCDGMT--------------YEEIE---------KEYPEDFKARDNDKY 332

  Fly   664 -------------------VILQLLEQTTGNILVVAHATTL 685
                               ||::|..|.  |:|::.|...|
Yeast   333 EYRYRGGESYRDVVIRLEPVIMELERQE--NVLIITHQAVL 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13604NP_001262894.1 UBA_UBS3B 23..60 CDD:270486
SH3_UBASH3 275..333 CDD:212725 10/50 (20%)
His_Phos_1 494..728 CDD:278716 41/213 (19%)
FBP26NP_012380.1 6PF2K 1..224 CDD:279872 35/214 (16%)
His_Phos_1 227..411 CDD:278716 41/213 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.